Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja atra Cytotoxin 4

Product Specifications

Product Name Alternative

Cardiotoxin A4 Short name: CTX A4 Cardiotoxin analog IV Short name: CTX IV

Abbreviation

Recombinant Naja atra Cytotoxin 4 protein

UniProt

P01443

Expression Region

22-81aa

Organism

Naja atra (Chinese cobra)

Target Sequence

RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.

Molecular Weight

22.8 kDa

References & Citations

"Genomic structures of cardiotoxin 4 and cobrotoxin from Naja naja atra (Taiwan cobra) ."Chang L.-S., Lin J., Chou Y.-C., Hong E.Biochem. Biophys. Res. Commun. 239:756-762 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Piccolo Antibody (PCLO-01) [DyLight 550]
NBP2-62209R 0.1 mL

Mouse Monoclonal Piccolo Antibody (PCLO-01) [DyLight 550]

Sign In for Pricing
View Details
Anti-Mouse IgG (H+L), Human Serum Adsorbed - 30nm Gold Conjugate
AC-30-15-05 0.5 mL

Anti-Mouse IgG (H+L), Human Serum Adsorbed - 30nm Gold Conjugate

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Recombinant Oenothera elata subsp. hookeri Photosystem II reaction center protein H (psbH)
MBS1041896 Inquire

Recombinant Oenothera elata subsp. hookeri Photosystem II reaction center protein H (psbH)

Sign In for Pricing
View Details