Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS

Abbreviation

Recombinant Staphylococcus aureus acpS protein

Gene Name

AcpS

UniProt

Q6GF02

Expression Region

1-119aa

Organism

Staphylococcus aureus (strain MRSA252)

Target Sequence

MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Molecular Weight

29.6 kDa

References & Citations

"Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGF Receptor 2 Recombinant Rabbit Monoclonal Antibody [SU03-42]
ET1608-33 100 µL

VEGF Receptor 2 Recombinant Rabbit Monoclonal Antibody [SU03-42]

Sign In for Pricing
View Details
Quinoxyfen-d4
TRC-Q765502-1MG 1 mg

Quinoxyfen-d4

Sign In for Pricing
View Details
Canavalia ensiformis Gel -Con A- Immobilized Lectin
A-1104-25 25 mL

Canavalia ensiformis Gel -Con A- Immobilized Lectin

Sign In for Pricing
View Details
Pure Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-
L-1801-2 2 mg

Pure Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-

Sign In for Pricing
View Details
OR9G1 Human Gene Knockout Kit (CRISPR)
KN419778 1 Kit

OR9G1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5D3]
CF808985 100 µg

RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5D3]

Sign In for Pricing
View Details