Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS

Abbreviation

Recombinant Staphylococcus aureus acpS protein

Gene Name

AcpS

UniProt

Q6GF02

Expression Region

1-119aa

Organism

Staphylococcus aureus (strain MRSA252)

Target Sequence

MIHGIGVDLIEIDRIKVLYSKQPKLVERILTKNEQHKFNNFTHEQRKIEFLAGRFATKEAFSKALGTGLGKHVAFNDIDCYNDELGKPKIDYEGFIVHVSISHTEHYAMSQVVLEKSAF

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Molecular Weight

29.6 kDa

References & Citations

"Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance." Holden M.T.G., Feil E.J., Lindsay J.A., Peacock S.J., Day N.P.J., Enright M.C., Foster T.J., Moore C.E., Hurst L., Atkin R., Barron A., Bason N., Bentley S.D., Chillingworth C., Chillingworth T., Churcher C., Clark L., Corton C. Parkhill J.Proc. Natl. Acad. Sci. U.S.A. 101:9786-9791 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (HM47/A9), CF740 conjugate, 0.1mg/mL
BNC740477-500 1x 500 µL

CD79a (HM47/A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase-7 (CASP7) (NM_033338) Human Over-expression Lysate
LY429870 100 µg

Caspase-7 (CASP7) (NM_033338) Human Over-expression Lysate

Sign In for Pricing
View Details
(1’R,2S)-2-(1’,2’-Dihydroxyethyl)-6-fluorochromane
TRC-D449038-50MG 50 mg

(1’R,2S)-2-(1’,2’-Dihydroxyethyl)-6-fluorochromane

Sign In for Pricing
View Details
Recombinant Human AgRP/AGRP Protein (Fc Tag)
PKSH031895 50 µg

Recombinant Human AgRP/AGRP Protein (Fc Tag)

Sign In for Pricing
View Details
Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-UNEL-H0062-01 5x 96 Tests

Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-UNEL-H0062-02 15x 96 Tests

Uncoated Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details