Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triticum aestivum Glutenin, low molecular weight subunit 1D1

Product Specifications

Product Name Alternative

Glutenin; low molecular weight subunit 1D1

Abbreviation

Recombinant Triticum aestivum Glutenin, low molecular weight subunit 1D1 protein

UniProt

P10386

Expression Region

24-307aa

Organism

Triticum aestivum (Wheat)

Target Sequence

RCIPGLERPWQQQPLPPQQTFPQQPLFSQQQQQQLFPQQPSFSQQQPPFWQQQPPFSQQQPILPQQPPFSQQQQLVLPQQPPFSQQQQPVLPPQQSPFPQQQQQHQQLVQQQIPVVQPSILQQLNPCKVFLQQQCSPVAMPQRLARSQMLQQSSCHVMQQQCCQQLPQIPQQSRYEAIRAIIYSIILQEQQQVQGSIQSQQQQPQQLGQCVSQPQQQSQQQLGQQPQQQQLAQGTFLQPHQIAQLEVMTSIALRILPTMCSVNVPLYRTTTSVPFGVGTGVGAY

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.

Molecular Weight

48.5 kDa

References & Citations

"Molecular characterization of an active wheat LMW glutenin gene and its relation to other wheat and barley prolamin genes."Colot V., Bartels D., Thompson R., Flavell R.Mol. Gen. Genet. 216:81-90 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CYP11A1 Protein, His (Fc)-Avi-tagged
CYP11A1-2124M 50 µg

Recombinant Mouse CYP11A1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Bovine Tumor Necrosis Factor Related Apoptosis Inducing Ligand 3 (TRAIL-3) ELISA Kit
EIA06474Bo 1 Kit

Bovine Tumor Necrosis Factor Related Apoptosis Inducing Ligand 3 (TRAIL-3) ELISA Kit

Sign In for Pricing
View Details
(R) -t-Butyl (2,6-Dimethyl-3-oxohept-1-en-4-yl) carbamate
464084-01 10 mg

(R) -t-Butyl (2,6-Dimethyl-3-oxohept-1-en-4-yl) carbamate

Sign In for Pricing
View Details
(R) -t-Butyl (2,6-Dimethyl-3-oxohept-1-en-4-yl) carbamate
464084-02 100 mg

(R) -t-Butyl (2,6-Dimethyl-3-oxohept-1-en-4-yl) carbamate

Sign In for Pricing
View Details
Recombinant Hom a 6
A10S89 1 Each

Recombinant Hom a 6

Sign In for Pricing
View Details
Dolk (NM_177648) Mouse Tagged ORF Clone
MG208554 10 µg

Dolk (NM_177648) Mouse Tagged ORF Clone

Sign In for Pricing
View Details