Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hadronyche versuta Omega-hexatoxin-Hv1a

Product Specifications

Product Name Alternative

Omega-atracotoxin-Hv1a Short name: AcTx-Hv1 Short name: Omega-AcTx-Hv1a

Abbreviation

Recombinant Hadronyche versuta Omega-hexatoxin-Hv1a protein

UniProt

P56207

Expression Region

1-37aa

Organism

Hadronyche versuta (Blue mountains funnel-web spider) (Atrax versutus)

Target Sequence

SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1.2/CACNA1C, Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Reversibly and voltage-independently blocks both mid-low- (M-LVA) and high-voltage-activated (HVA) calcium channels in cockroach DUM neurons. Lethal to many insect orders but not toxic to mice or rabbits. May target the insect high-voltage-activated calcium channel Dmca1D. Also inhibits acarines calcium channels. An extremely high toxin concentration partially inhibits Cav1.2/CACNA1C, Cav2.1/CACNA1A and Cav2.2/CACNA1B calcium channel of rats. As for omega-AcTx-Hv2a, the phenotypic effect of injection of this toxin into lone star ticks (Amblyomma americanum) is curling of all eight legs into closed loops.

Molecular Weight

20.1 kDa

References & Citations

"The structure of a novel insecticidal neurotoxin, omega-atracotoxin-HV1, from the venom of an Australian funnel web spider."Fletcher J.I., Smith R., O'Donoghue S.I., Nilges M., Connor M., Howden M.E.H., Christie M.J., King G.F.Nat. Struct. Biol. 4:559-566 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ERBB3 Protein
ERBB3-02HM 50 µg

Recombinant Human ERBB3 Protein

Sign In for Pricing
View Details
Olr1195 3'UTR Lenti-reporter-Luc Vector
33733086 1.0 µg

Olr1195 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PPP1R2P6 Protein Vector (Human) (pPB-C-His)
PV112830 500 ng

PPP1R2P6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human TIGAR Protein, N-His
YHN33701 100 μg

Recombinant Human TIGAR Protein, N-His

Sign In for Pricing
View Details
Recombinant Acinetobacter sp. Phosphate acetyltransferase (pta), partial
MBS1396340 Inquire

Recombinant Acinetobacter sp. Phosphate acetyltransferase (pta), partial

Sign In for Pricing
View Details
Gentamicin Sulphate for Lab Use
103935-01 1 g

Gentamicin Sulphate for Lab Use

Sign In for Pricing
View Details