Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Eukaryotic translation initiation factor 5A-1 (HYP2)

Product Specifications

Product Name Alternative

Hypusine-containing protein HP2 eIF-4D

Abbreviation

Recombinant Saccharomyces cerevisiae HYP2 protein

Gene Name

HYP2

UniProt

P23301

Expression Region

2-157aa

Organism

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Target Sequence

SDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

MRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

MRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Essential for polarized growth, a process necessary for G1/S transition. May mediate large range of effects of the polyamine spermidine in the cell.

Molecular Weight

33 kDa

References & Citations

"Translation initiation factor 5A and its hypusine modification are essential for cell viability in the yeast Saccharomyces cerevisiae." Schnier J., Schwelberger H.G., Smit-Mcbride Z., Kang H.A., Hershey J.W.B.Mol. Cell. Biol. 11:3105-3114 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS700845 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Myostatin Propeptide (MSTN) (NM_005259) Human Over-expression Lysate
LY401622 100 µg

Myostatin Propeptide (MSTN) (NM_005259) Human Over-expression Lysate

Sign In for Pricing
View Details
Cardiac Troponin I (TNNI3) Rabbit Polyclonal Antibody
AP06440PU-N 100 µg

Cardiac Troponin I (TNNI3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD117 (KIT/982), CF405S conjugate, 0.1mg/mL
BNC040982-500 1x 500 µL

CD117 (KIT/982), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Concanavalin A, CF®405M Conjugate
#29074 5x 1 mg

Concanavalin A, CF®405M Conjugate

Sign In for Pricing
View Details
CD30 (Ki-1/779), Biotin conjugate, 0.1mg/mL
BNCB0779-100 1x 100 µL

CD30 (Ki-1/779), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details