Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Decorin (DCN)

Product Specifications

Product Name Alternative

Bone proteoglycan II PG-S2

Abbreviation

Recombinant Bovine DCN protein

Gene Name

DCN

UniProt

P21793

Expression Region

31-360aa

Organism

Bos taurus (Bovine)

Target Sequence

DEASGIGPEEHFPEVPEIEPMGPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQLGNYK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

May affect the rate of fibrils formation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May affect the rate of fibrils formation.

Molecular Weight

38.5 kDa

References & Citations

"Molecular cloning and sequence analysis of the cDNA for small proteoglycan II of bovine bone."Day A.A., McQuillan C.I., Termine J.D., Young M.R.Biochem. J. 248:801-805 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine ApoA5 (Apolipoprotein A5) ELISA Kit
MBS2508414-01 24 Tests

Porcine ApoA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
Porcine ApoA5 (Apolipoprotein A5) ELISA Kit
MBS2508414-02 48 Tests

Porcine ApoA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
Porcine ApoA5 (Apolipoprotein A5) ELISA Kit
MBS2508414-03 96 Tests

Porcine ApoA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
Porcine ApoA5 (Apolipoprotein A5) ELISA Kit
MBS2508414-04 5x 96 Tests

Porcine ApoA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
Porcine ApoA5 (Apolipoprotein A5) ELISA Kit
MBS2508414-05 10x 96 Tests

Porcine ApoA5 (Apolipoprotein A5) ELISA Kit

Sign In for Pricing
View Details
MYL3 Antibody Blocking peptide
orb1455975 500 µg

MYL3 Antibody Blocking peptide

Sign In for Pricing
View Details