Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial

Product Specifications

Product Name Alternative

Divergent of neuregulin-1 Short name: DON-1 Neural- and thymus-derived activator for ERBB kinases Short name: NTAK

Abbreviation

Recombinant Human NRG2 protein, partial

Gene Name

NRG2

UniProt

O14511

Expression Region

112-405aa

Organism

Homo sapiens (Human)

Target Sequence

CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Molecular Weight

34.8 kDa

References & Citations

"A novel brain-derived member of the epidermal growth factor family that interacts with ErbB3 and ErbB4."Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N., Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N., Ishiguro H.J. Biochem. 122:675-680 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbfox2 ORF Vector (Mouse) (pORF)
ORF055686 1.0 µg DNA

Rbfox2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mpped1 3'UTR Luciferase Stable Cell Line
TU213348 1.0 mL

Mpped1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human MYL3 Protein, His (Fc)-Avi-tagged
MYL3-1468H 50 µg

Recombinant Human MYL3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Genorise® Biotinylated Guinea Pig RANKL Polyclonal Antibody
GR213054 50 µg

Genorise® Biotinylated Guinea Pig RANKL Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Abhydrolase domain containing protein 16B (C20orf135) ELISA kit
GTR10475982 96 Well

Mouse Abhydrolase domain containing protein 16B (C20orf135) ELISA kit

Sign In for Pricing
View Details
Anti-Fas Antibody Picoband® (Dylight488 Conjugate)
PA1119-Dylight488 100 µg

Anti-Fas Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details