Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB17, Human (His)

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZBTB17 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zbtb17-protein-human-his.html

Purity

95.0

Smiles

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA

Molecular Formula

7709 (Gene_ID) Q13105 (M1-A188) (Accession)

Molecular Weight

Approximately 18.0-26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF594 conjugate, 0.1mg/mL
BNC940045-500 1x 500 µL

Bcl-2 (100/D5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-alpha (HCGa/53), CF647 conjugate, 0.1mg/mL
BNC470053-100 1x 100 µL

HCG-alpha (HCGa/53), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF647 conjugate, 0.1mg/mL
BNC472250-100 1x 100 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details