Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB17, Human (His)

The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ZBTB17 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/zbtb17-protein-human-his.html

Purity

95.0

Smiles

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA

Molecular Formula

7709 (Gene_ID) Q13105 (M1-A188) (Accession)

Molecular Weight

Approximately 18.0-26.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF365 qPCR Primer Pair
QH34221S 200 Tests

Human ZNF365 qPCR Primer Pair

Sign In for Pricing
View Details
KBTBD7 Recombinant Protein (Rat)
RP206672 100 µg

KBTBD7 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human a1AT (Alpha-1-Antitrypsin) ELISA Kit
EK241659 96 Well

Human a1AT (Alpha-1-Antitrypsin) ELISA Kit

Sign In for Pricing
View Details
Spin4 (NM_178753) Mouse Recombinant Protein
PM47903M5 20 µg

Spin4 (NM_178753) Mouse Recombinant Protein

Sign In for Pricing
View Details
T-611 free base
orb1699191-01 25 mg

T-611 free base

Sign In for Pricing
View Details
T-611 free base
orb1699191-02 50 mg

T-611 free base

Sign In for Pricing
View Details