Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonucleoprotein PTB-binding 2 (RAVER2), partial

Product Specifications

Product Name Alternative

Protein raver-2

Abbreviation

Recombinant Human RAVER2 protein, partial

Gene Name

RAVER2

UniProt

Q9HCJ3

Expression Region

1-140aa

Organism

Homo sapiens (Human)

Target Sequence

MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May bind single-stranded nucleic acids.Curated

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May bind single-stranded nucleic acids.

Molecular Weight

17 kDa

References & Citations

Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.DNA Res. 7:273-281 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-N-Boc-5'-O-DMT-3'-O-Nosyl Thymidine
TRC-N212160-25MG 25 mg

3-N-Boc-5'-O-DMT-3'-O-Nosyl Thymidine

Sign In for Pricing
View Details
Recombinant Human CNTFR/CNTFR-alpha Protein (His Tag)
PKSH031308 100 µg

Recombinant Human CNTFR/CNTFR-alpha Protein (His Tag)

Sign In for Pricing
View Details
Human RBP4 Recombinant Rabbit monoclonal Antibody
HA723690B 100 µL

Human RBP4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BubR1 (BUB1B) (NM_001211) Human Over-expression Lysate
LY420068 100 µg

BubR1 (BUB1B) (NM_001211) Human Over-expression Lysate

Sign In for Pricing
View Details
Polink TS-MRRt-Ms A Kit
TS312A-60 60 mL

Polink TS-MRRt-Ms A Kit

Sign In for Pricing
View Details
GPR119 Rabbit Polyclonal Antibody
AP01207PU-N 100 µg

GPR119 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details