Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Suppressor of SWI4 1 homolog (PPAN)

Product Specifications

Product Name Alternative

Brix domain-containing protein 3; Peter Pan homolog

Abbreviation

Recombinant Human PPAN protein

Gene Name

PPAN

UniProt

Q9NQ55

Expression Region

1-473aa

Organism

Homo sapiens (Human)

Target Sequence

MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

May have a role in cell growth.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May have a role in cell growth.

Molecular Weight

55.2 kDa

References & Citations

Cloning, genomic organization, and tissue distribution of human Ssf-1.Suarez-Huerta N., Boeynaems J.-M., Communi D.Biochem. Biophys. Res. Commun. 275:37-42 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf156, CT (Nef-associated protein 1, Thioesterase NAP1, HSPC219, NAP1, C9orf156) (MaxLight 405) discontinued
C5071-09V-ML405 100 µL

C9orf156, CT (Nef-associated protein 1, Thioesterase NAP1, HSPC219, NAP1, C9orf156) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal ZAG Antibody (Zagy-1) [PerCP]
NBP2-80083PCP 0.1 mL

Mouse Monoclonal ZAG Antibody (Zagy-1) [PerCP]

Sign In for Pricing
View Details
Resazurin Cell Viability Kit
TBS2001-5K 5000 Tests

Resazurin Cell Viability Kit

Sign In for Pricing
View Details
GPM6A Rabbit Polyclonal Antibody
E53P12661 100 µL

GPM6A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD79B Antibody (IGB/2555)
NBP3-07420-100ug 100 µg

Mouse Monoclonal CD79B Antibody (IGB/2555)

Sign In for Pricing
View Details
LOC685099 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7510304 1.0 µg DNA

LOC685099 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details