Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LentimiRa-mmu-miR-7653-5p Vector
mm42024 500 ng

LentimiRa-mmu-miR-7653-5p Vector

Ask
View Details
Bovine UDP-glucuronosyltransferase 3A1, UGT3A1 ELISA KIT
ELI-17743b 96 Tests

Bovine UDP-glucuronosyltransferase 3A1, UGT3A1 ELISA KIT

Ask
View Details
Guinea Pig Superoxide Dismutase 2, Mitochondrial (SOD2) ELISA Kit
MBS9300452 Inquire

Guinea Pig Superoxide Dismutase 2, Mitochondrial (SOD2) ELISA Kit

Ask
View Details