Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Epidermal Growth Factor (EGF) Receptor Peptide (985-996) (human)
E3374-17A 1 mg

Epidermal Growth Factor (EGF) Receptor Peptide (985-996) (human)

Ask
View Details
Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT
E2300Ra-01 48 Well

Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT

Ask
View Details
Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT
E2300Ra-02 96 Well

Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT

Ask
View Details
Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT
E2300Ra-03 5x 96 Tests

Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT

Ask
View Details
Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT
E2300Ra-04 10x 96 Tests

Rat Tripartite motif-containing protein 69, TRIM69 ELISA KIT

Ask
View Details
Recombinant Human CD307a/FCRL1 Protein, N-His
E55P5913 50 µg

Recombinant Human CD307a/FCRL1 Protein, N-His

Ask
View Details