Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Wfdc15b Protein Vector (Rat) (pPM-C-HA)
50404026 500 ng

Wfdc15b Protein Vector (Rat) (pPM-C-HA)

Ask
View Details
Cdk5, p31 (Cyclin-dependent Kinase 5) (APC) discontinued
C2575-06A-APC 100 µL

Cdk5, p31 (Cyclin-dependent Kinase 5) (APC) discontinued

Ask
View Details
PLV3-UBC-CASPASE3-mut-3xFLAG-Hygro Plasmid
PVT80154 2 µg

PLV3-UBC-CASPASE3-mut-3xFLAG-Hygro Plasmid

Ask
View Details
SOCS4 Human Gene Knockout Kit (CRISPR)
KN409202 1 Kit

SOCS4 Human Gene Knockout Kit (CRISPR)

Ask
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) FOLM Polyclonal Antibody
MBS7189825 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) FOLM Polyclonal Antibody

Ask
View Details
ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (Biotin)
MBS6173463-01 0.1 mL

ZBTB25 (Zinc Finger and BTB Domain Containing 25, KUP, ZNF46) (Biotin)

Ask
View Details