Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NOG2 Rabbit Polyclonal Antibody
E28PN1006 100 µL

NOG2 Rabbit Polyclonal Antibody

Ask
View Details
RNF219, ID (RNF219, C13orf7, RING finger protein 219) (FITC) discontinued
041137-FITC 200 µL

RNF219, ID (RNF219, C13orf7, RING finger protein 219) (FITC) discontinued

Ask
View Details
Mouse Monoclonal AKR1B1 Antibody (CPTC-AKR1B1-3) [DyLight 594]
NBP2-79930DL594 0.1 mL

Mouse Monoclonal AKR1B1 Antibody (CPTC-AKR1B1-3) [DyLight 594]

Ask
View Details
Tin2 (TINF2) Human siRNA Oligo Duplex (Locus ID 26277)
SR308808 1 Kit

Tin2 (TINF2) Human siRNA Oligo Duplex (Locus ID 26277)

Ask
View Details
UBE2Z Antibody (C-term) [APR04192G]
APR04192G-01 50 µL

UBE2Z Antibody (C-term) [APR04192G]

Ask
View Details
UBE2Z Antibody (C-term) [APR04192G]
APR04192G-02 100 µL

UBE2Z Antibody (C-term) [APR04192G]

Ask
View Details