Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LRIT1, CT (LRIT1, LRRC21, PAL, Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1, Leucine-rich repeat-containing protein 21, Photoreceptor-associated LRR superfamily protein, Retina-specific protein PAL)
MBS645249-01 0.2 mL

LRIT1, CT (LRIT1, LRRC21, PAL, Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1, Leucine-rich repeat-containing protein 21, Photoreceptor-associated LRR superfamily protein, Retina-specific protein PAL)

Ask
View Details
LRIT1, CT (LRIT1, LRRC21, PAL, Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1, Leucine-rich repeat-containing protein 21, Photoreceptor-associated LRR superfamily protein, Retina-specific protein PAL)
MBS645249-02 5x 0.2 mL

LRIT1, CT (LRIT1, LRRC21, PAL, Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 1, Leucine-rich repeat-containing protein 21, Photoreceptor-associated LRR superfamily protein, Retina-specific protein PAL)

Ask
View Details
Calsenilin/KCNIP3 BioAssayTM ELISA Kit
471812 96 Tests

Calsenilin/KCNIP3 BioAssayTM ELISA Kit

Ask
View Details
Rabbit Monoclonal IL-13R alpha 1 Antibody (122) [CoraFluor 1]
NBP2-90409CL1 0.1 mL

Rabbit Monoclonal IL-13R alpha 1 Antibody (122) [CoraFluor 1]

Ask
View Details
Palmitoyltransferase ZDHHC7 (ZDHHC7) Human ELISA Kit
F6712 96 Tests

Palmitoyltransferase ZDHHC7 (ZDHHC7) Human ELISA Kit

Ask
View Details
ACE2 mutant protein:W349G, human, recombinant (hFc Tag)
NCP0098 1 mg

ACE2 mutant protein:W349G, human, recombinant (hFc Tag)

Ask
View Details