Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human C17orf74 shRNA Plasmid
abx966283-01 150 µg

Human C17orf74 shRNA Plasmid

Ask
View Details
Human C17orf74 shRNA Plasmid
abx966283-02 300 µg

Human C17orf74 shRNA Plasmid

Ask
View Details
Mouse Growth Differentiation Factor 3 (GDF3) ELISA Kit-Sandwich
EK6F171-01 48 Test

Mouse Growth Differentiation Factor 3 (GDF3) ELISA Kit-Sandwich

Ask
View Details
Mouse Growth Differentiation Factor 3 (GDF3) ELISA Kit-Sandwich
EK6F171-02 96 Tests

Mouse Growth Differentiation Factor 3 (GDF3) ELISA Kit-Sandwich

Ask
View Details
OR1K1 Human shRNA Lentiviral Particle (Locus ID 392392)
TL302791V 500 µL Each

OR1K1 Human shRNA Lentiviral Particle (Locus ID 392392)

Ask
View Details
MCA Assay Kit
E47S407M 100 Tests - 96 Samples

MCA Assay Kit

Ask
View Details