Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 beta, Rat (His)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple inflammatory responses, including prostaglandin synthesis, neutrophil, T-cell and B-cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Rat (His) is the recombinant rat-derived IL-1 beta protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-1 beta Protein, Rat (His), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-beta-rat-hek293.html

Purity

95.00

Smiles

VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Molecular Formula

24494 (Gene_ID) Q5BKB0 (V117-S268) (Accession)

Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Stapp JM, et al. Recombinant rat IL-1beta and IL-6 synergistically enhance C3 mRNA levels and complementcomponent C3 secretion by H-35 rat hepatoma cells. Cytokine. 2005 Apr 21;30 (2) :78-85.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Niacin Receptor 1 (NIACR1) ELISA Kit
MBS9398224 Inquire

Goat Niacin Receptor 1 (NIACR1) ELISA Kit

Ask
View Details
Human MIR644A qPCR Primer Pair
QH81693S 200 Tests

Human MIR644A qPCR Primer Pair

Ask
View Details
HMX1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-06757 0.1 mg

HMX1 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
PDLIM2 Antibody
A45408-100UL 100 µL

PDLIM2 Antibody

Ask
View Details
DHDH Rabbit Polyclonal Antibody
E28PN8619 100 µL

DHDH Rabbit Polyclonal Antibody

Ask
View Details
ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (AP) discontinued
044214-AP 200 µL

ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (AP) discontinued

Ask
View Details