Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arachis hypogaea Arachin Ahy-3, partial

Product Specifications

Product Name Alternative

Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha; Arachin Ahy-3 chain beta]

Abbreviation

Recombinant Arachis hypogaea Arachin Ahy-3 protein, partial

UniProt

Q647H2

Expression Region

299-478aa

Organism

Arachis hypogaea (Peanut)

Target Sequence

GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.9 kDa

References & Citations

Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZSWIM7 activation kit by CRISPRa
GA114885 1 Kit

Human ZSWIM7 activation kit by CRISPRa

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF647 conjugate, 0.1mg/mL
BNC471893-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS623345 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL
BNC742929-500 1x 500 µL

RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Rat gp130 (Glucoprotein 130) ELISA Kit
E-UNEL-R0034-01 5x 96 Tests

Uncoated Rat gp130 (Glucoprotein 130) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat gp130 (Glucoprotein 130) ELISA Kit
E-UNEL-R0034-02 15x 96 Tests

Uncoated Rat gp130 (Glucoprotein 130) ELISA Kit

Sign In for Pricing
View Details