Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

Product Specifications

Product Name Alternative

Alpha-toxin

Abbreviation

Recombinant Staphylococcus aureus hly protein

Gene Name

Hly

UniProt

Q2G1X0

Expression Region

27-319aa

Organism

Staphylococcus aureus (strain NCTC 8325)

Target Sequence

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Alpha-toxin binds to the mbrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity (By similarity) .

Molecular Weight

35.3 kDa

References & Citations

Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.Sibbald M.J., Winter T., van der Kooi-Pol M.M., Buist G., Tsompanidou E., Bosma T., Schafer T., Ohlsen K., Hecker M., Antelmann H., Engelmann S., van Dijl J.M.J. Bacteriol. 192:3788-3800 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pancreatic secretory trypsin inhibitor ELISA Kit
MBS763970-01 48 Well

Human Pancreatic secretory trypsin inhibitor ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic secretory trypsin inhibitor ELISA Kit
MBS763970-02 96 Well

Human Pancreatic secretory trypsin inhibitor ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic secretory trypsin inhibitor ELISA Kit
MBS763970-03 5x 96 Well

Human Pancreatic secretory trypsin inhibitor ELISA Kit

Sign In for Pricing
View Details
Human Pancreatic secretory trypsin inhibitor ELISA Kit
MBS763970-04 10x 96 Well

Human Pancreatic secretory trypsin inhibitor ELISA Kit

Sign In for Pricing
View Details
ABCA6 Antibody Blocking peptide
orb1445059 500 µg

ABCA6 Antibody Blocking peptide

Sign In for Pricing
View Details
Rat Coagulation Factor X ELISA Kit
MBS031776-01 48 Well

Rat Coagulation Factor X ELISA Kit

Sign In for Pricing
View Details