Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Scrapie-responsive protein 1 (SCRG1)

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein ; ScRG-1

Abbreviation

Recombinant Human SCRG1 protein

Gene Name

SCRG1

UniProt

O75711

Expression Region

21-98aa

Organism

Homo sapiens (Human)

Target Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

References & Citations

Characterization of the human analogue of a scrapie-responsive gene.Dron M., Dandoy-Dron F., Guillo F., Benboudjema L., Hauw J.-J., Lebon P., Dormont D., Tovey M.G.J. Biol. Chem. 273:18015-18018 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF568 conjugate, 0.1mg/mL
BNC682730-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL2 Antibody
KC-338-01 50 μL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-338-02 100 µL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-338-03 1 mL

IL2 Antibody

Sign In for Pricing
View Details
Human TBC1D10A activation kit by CRISPRa
GA113286 1 Kit

Human TBC1D10A activation kit by CRISPRa

Sign In for Pricing
View Details
IFNA14 (NM_002172) Human Over-expression Lysate
LC419489 20 µg

IFNA14 (NM_002172) Human Over-expression Lysate

Sign In for Pricing
View Details