Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Scrapie-responsive protein 1 (SCRG1)

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein ; ScRG-1

Abbreviation

Recombinant Human SCRG1 protein

Gene Name

SCRG1

UniProt

O75711

Expression Region

21-98aa

Organism

Homo sapiens (Human)

Target Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

References & Citations

Characterization of the human analogue of a scrapie-responsive gene.Dron M., Dandoy-Dron F., Guillo F., Benboudjema L., Hauw J.-J., Lebon P., Dormont D., Tovey M.G.J. Biol. Chem. 273:18015-18018 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Cbz-L-aspartic Acid
TRC-C176285-25G 25 g

N-Cbz-L-aspartic Acid

Sign In for Pricing
View Details
CD70 Human Gene Knockout Kit (CRISPR)
KN400410 1 Kit

CD70 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TRIM52 activation kit by CRISPRa
GA113717 1 Kit

Human TRIM52 activation kit by CRISPRa

Sign In for Pricing
View Details
MRPL15 Mouse Monoclonal Antibody [Clone ID: OTI10D3]
CF807729 100 µg

MRPL15 Mouse Monoclonal Antibody [Clone ID: OTI10D3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800352 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS639220 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details