Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Scrapie-responsive protein 1 (SCRG1)

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein ; ScRG-1

Abbreviation

Recombinant Human SCRG1 protein

Gene Name

SCRG1

UniProt

O75711

Expression Region

21-98aa

Organism

Homo sapiens (Human)

Target Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.9 kDa

References & Citations

Characterization of the human analogue of a scrapie-responsive gene.Dron M., Dandoy-Dron F., Guillo F., Benboudjema L., Hauw J.-J., Lebon P., Dormont D., Tovey M.G.J. Biol. Chem. 273:18015-18018 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (TNF656), CF405S conjugate, 0.1mg/mL
BNC040656-100 1x 100 µL

TNF alpha (TNF656), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-c-Jun (S63) Recombinant Rabbit monoclonal Antibody
HA750146 100 µL

Phospho-c-Jun (S63) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Dusp9 Mouse Gene Knockout Kit (CRISPR)
KN304885BN 1 Kit

Dusp9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AccuBlue® Broad Range dsDNA Quantitation Kit with DNA Standard, trial size (200 assays)
#31007-T 1 Kit

AccuBlue® Broad Range dsDNA Quantitation Kit with DNA Standard, trial size (200 assays)

Sign In for Pricing
View Details
TYRO3 (NM_006293) Human Recombinant Protein
TP308260 20 µg

TYRO3 (NM_006293) Human Recombinant Protein

Sign In for Pricing
View Details
CA199 Polyclonal Antibody
D-AB-10468L-01 25 µL

CA199 Polyclonal Antibody

Sign In for Pricing
View Details