Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Scrapie-responsive protein 1 (Scrg1)

Product Specifications

Product Name Alternative

Scrapie-responsive gene 1 protein ; ScRG-1

Abbreviation

Recombinant Mouse Scrg1 protein

Gene Name

Scrg1

UniProt

O88745

Expression Region

21-98aa

Organism

Mus musculus (Mouse)

Target Sequence

MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

11 kDa

References & Citations

Gene expression in scrapie. Cloning of a new scrapie-responsive gene and the identification of increased levels of seven other mRNA transcripts.Dandoy-Dron F., Guillo F., Benboudjema L., Deslys J.-P., Lasmesas C., Dormont D., Tovey M.G., Dron M.J. Biol. Chem. 273:7691-7697 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MRPS15 Mouse Monoclonal Antibody [Clone ID: OTI6D2]
M13979 100 µL

Anti-MRPS15 Mouse Monoclonal Antibody [Clone ID: OTI6D2]

Sign In for Pricing
View Details
Human NLRP6/NALP6 Alexa Fluor 488 Antibody (Clone 920631)
IC9145G-100UG 100 µg

Human NLRP6/NALP6 Alexa Fluor 488 Antibody (Clone 920631)

Sign In for Pricing
View Details
Human Follistatin ELISA Kit
MBS2880959-01 48 Well

Human Follistatin ELISA Kit

Sign In for Pricing
View Details
Human Follistatin ELISA Kit
MBS2880959-02 96 Well

Human Follistatin ELISA Kit

Sign In for Pricing
View Details
Human Follistatin ELISA Kit
MBS2880959-03 5x 96 Well

Human Follistatin ELISA Kit

Sign In for Pricing
View Details
Human Follistatin ELISA Kit
MBS2880959-04 10x 96 Well

Human Follistatin ELISA Kit

Sign In for Pricing
View Details