Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase

Product Specifications

Product Name Alternative

Thrombin-like enzyme crotalase; SVTLE; EC 3.4.21.74; Fibrinogen-clotting enzyme; Snake venom serine protease 2; SVSP

Abbreviation

Recombinant Crotalus adamanteus Thrombin-like enzyme crotalase protein

UniProt

F8S114

Expression Region

25-262aa

Organism

Crotalus adamanteus (Eastern diamondback rattlesnake)

Target Sequence

VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thrombin-like snake venom protein that release fibrinopeptide A from fibrinogen (FGA) . Shows both kinin-releasing and coagulant activities.

Molecular Weight

28.8 kDa

References & Citations

Kallikrein-like activity of crotalase, a snake venom enzyme that clots fibrinogen.Markland F.S., Kettner C., Schiffman S., Shaw E., Bajwa S.S., Reddy K.N., Kirakossian H., Patkos G.B., Theodor I., Pirkle H.Proc. Natl. Acad. Sci. U.S.A. 79:1688-1692 (1982)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-500 1x 500 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF640R conjugate, 0.1mg/mL
BNC400532-100 1x 100 µL

Cytokeratin 14 (KRT14/532), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL
BNC471919-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details