Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia phage T7 Single-stranded DNA-binding protein (2.5)

Product Specifications

Product Name Alternative

2.5Single-stranded DNA-binding protein gp2.5; SSB protein

Abbreviation

Recombinant Escherichia phage T7 2.5 protein

Gene Name

2.5

UniProt

P03696

Expression Region

1-232aa

Organism

Escherichia phage T7 (Bacteriophage T7)

Target Sequence

MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF

Tag

Tag-Free

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.

Molecular Weight

25.7 kDa

References & Citations

Essential residues in the C terminus of the bacteriophage T7 gene 2.5 single-stranded DNA-binding protein.Marintcheva B., Hamdan S.M., Lee S.J., Richardson C.C.J. Biol. Chem. 281:25831-25840 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKAL1 AAV Vector (Human) (CMV)
15719102 1 µg

CDKAL1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PPARA | PPAR alpha Recombinant Rabbit mAb
orb3126814-01 25 µL

PPARA | PPAR alpha Recombinant Rabbit mAb

Sign In for Pricing
View Details
PPARA | PPAR alpha Recombinant Rabbit mAb
orb3126814-02 50 µL

PPARA | PPAR alpha Recombinant Rabbit mAb

Sign In for Pricing
View Details
PPARA | PPAR alpha Recombinant Rabbit mAb
orb3126814-03 100 µL

PPARA | PPAR alpha Recombinant Rabbit mAb

Sign In for Pricing
View Details
ZNF627 HDR Plasmid (h)
sc-409066-HDR 20 µg

ZNF627 HDR Plasmid (h)

Sign In for Pricing
View Details
Rabbit anti-CSTF64 Antibody, Affinity Purified
A301-093A-T 2 µg

Rabbit anti-CSTF64 Antibody, Affinity Purified

Sign In for Pricing
View Details