What sizes are available for Recombinant Mouse Major urinary protein 11 (Mup11), partial?

Recombinant Mouse Major urinary protein 11 (Mup11), partial is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 100 µg, 1 mg, 20 µg.

How many pack sizes does Recombinant Mouse Major urinary protein 11 (Mup11), partial come in?

Recombinant Mouse Major urinary protein 11 (Mup11), partial is available in 7 different pack sizes.

Who manufactures Recombinant Mouse Major urinary protein 11 (Mup11), partial?

Recombinant Mouse Major urinary protein 11 (Mup11), partial is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Mouse Major urinary protein 11 (Mup11), partial?

Estimated delivery time for Recombinant Mouse Major urinary protein 11 (Mup11), partial is approximately 15 business day(s), depending on your location.

Recombinant Mouse Major urinary protein 11 (Mup11), partial

Q: What is the catalog number for Recombinant Mouse Major urinary protein 11 (Mup11), partial?

The catalog number for Recombinant Mouse Major urinary protein 11 (Mup11), partial is CSB-YP361419MO.

Product Specifications

Product Name Alternative

MUP11 and MUP8

Abbreviation

Recombinant Mouse Mup11 protein, partial

Gene Name

Mup11

UniProt

P04938

Expression Region

32-181aa

Organism

Mus musculus (Mouse)

Target Sequence

EKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable) . Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro

Molecular Weight

19.6 kDa

References & Citations

Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.