Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit beta-2 (Hbb-b2)

Product Specifications

Product Name Alternative

Beta-2-globinHemoglobin beta-2 chainHemoglobin beta-minor chain

Abbreviation

Recombinant Mouse Hbb-b2 protein

Gene Name

Hbb-b2

UniProt

P02089

Expression Region

2-147aa

Organism

Mus musculus (Mouse)

Target Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Involved in oxygen transport from the lung to the various peripheral tissues.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in oxygen transport from the lung to the various peripheral tissues.

Molecular Weight

17.7 kDa

References & Citations

Nucleotide sequence of the BALB/c mouse beta-globin complex.Shehee W.R., Loeb D.D., Adey N.B., Burton F.H., Casavant N.C., Cole P., Davies C.J., McGraw R.A., Schichman S.A., Severynse D.M., Voliva C.F., Weyter F.W., Wisely G.B., Edgell M.H., Hutchison C.A. IIIJ. Mol. Biol. 205:41-62 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAG2, Recombinant, Human, aa1-211, GST-Tag (BAG Family Molecular Chaperone Regulator 2)
372401-01 20 µg

BAG2, Recombinant, Human, aa1-211, GST-Tag (BAG Family Molecular Chaperone Regulator 2)

Sign In for Pricing
View Details
BAG2, Recombinant, Human, aa1-211, GST-Tag (BAG Family Molecular Chaperone Regulator 2)
372401-02 100 µg

BAG2, Recombinant, Human, aa1-211, GST-Tag (BAG Family Molecular Chaperone Regulator 2)

Sign In for Pricing
View Details
BAG2, Recombinant, Human, aa1-211, GST-Tag (BAG Family Molecular Chaperone Regulator 2)
372401-03 1 mg

BAG2, Recombinant, Human, aa1-211, GST-Tag (BAG Family Molecular Chaperone Regulator 2)

Sign In for Pricing
View Details
PLCG2 Mouse Monoclonal Antibody
AMM81489-01 1 Each

PLCG2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PLCG2 Mouse Monoclonal Antibody
AMM81489-02 50 µL

PLCG2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
PLCG2 Mouse Monoclonal Antibody
AMM81489-03 100 µL

PLCG2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details