Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Product Specifications

Product Name Alternative

RRNA N-glycosidase

Abbreviation

Recombinant Trichosanthes kirilowii rRNA N-glycosidase protein

UniProt

P09989

Expression Region

24-270aa

Organism

Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Target Sequence

DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Inactivates eukaryotic 60S ribosomal subunits.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inactivates eukaryotic 60S ribosomal subunits.

Molecular Weight

29.1 kDa

References & Citations

"Crystal structures of the complexes of trichosanthin with four substrate analogs and catalytic mechanism of RNA N-glycosidase."Gu Y.J., Xia Z.X.Proteins 39:37-46 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PSD-95 Antibody
NB300-294 0.1 mL

Rabbit Polyclonal PSD-95 Antibody

Sign In for Pricing
View Details
HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (PE)
MBS6184846-01 0.1 mL

HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (PE)

Sign In for Pricing
View Details
HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (PE)
MBS6184846-02 5x 0.1 mL

HES2 (Hairy and Enhancer of Split 2 (Drosophila), bHLHb40) (PE)

Sign In for Pricing
View Details
SLC43A3 (Solute Carrier Family 43 Member 3, Protein FOAP-13, PSEC0252, DKFZp762A227, Eeg1, EEG1, PRO1659) (HRP)
138378-HRP 100 µL

SLC43A3 (Solute Carrier Family 43 Member 3, Protein FOAP-13, PSEC0252, DKFZp762A227, Eeg1, EEG1, PRO1659) (HRP)

Sign In for Pricing
View Details
6-Amino-pyridazine-3-carboxylic acid
261354-01 250 mg

6-Amino-pyridazine-3-carboxylic acid

Sign In for Pricing
View Details
6-Amino-pyridazine-3-carboxylic acid
261354-02 500 mg

6-Amino-pyridazine-3-carboxylic acid

Sign In for Pricing
View Details