Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)
Product Specifications
Product Name Alternative
Verocytotoxin 2 subunit B ; Verotoxin 2 subunit B
Abbreviation
Recombinant Enterobacteria phage 933W stxB2 protein
Gene Name
StxB2
UniProt
P09386
Expression Region
20-89aa
Organism
Enterobacteria phage 933W (Bacteriophage 933W)
Target Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
Yeast
Field of Research
Others
Relevance
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Molecular Weight
9.8 kDa
References & Citations
Nucleotide sequence analysis and comparison of the structural genes for Shiga-like toxin I and Shiga-like toxin II encoded by bacteriophages from Escherichia coli 933.Jackson M.P., Neill R.J., O'Brien A.D., Holmes R.K., Newland J.W.FEMS Microbiol. Lett. 44:109-114 (1987)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680994-100 1x 100 µL
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740050-500 1x 500 µL
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882035-500 1x 500 µL
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882400-500 1x 500 µL
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470774-500 1x 500 µL
HSP27 (HSPB1/774), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details