Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli 8-oxo-dGTP diphosphatase (mutT)

Product Specifications

Product Name Alternative

7,8-dihydro-8-oxoguanine-triphosphatase; Mutator protein MutTdGTP pyrophosphohydrolase

Abbreviation

Recombinant E.coli mutT protein

Gene Name

MutT

UniProt

P08337

Expression Region

1-129aa

Organism

Escherichia coli (strain K12)

Target Sequence

MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Involved in the GO syst responsible for roving an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite dA and dC residues of tplate DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the GO system responsible for removing an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite dA and dC residues of template DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate.

Molecular Weight

16.9 kDa

References & Citations

Characterization of the mutT nucleoside triphosphatase of Escherichia coli.Bhatnagar S.K., Bullions L.C., Bessman M.J.J. Biol. Chem. 266:9050-9054 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ablim2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4770705 3x 1.0 µg

Ablim2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal GLIS3 Antibody (PCRP-GLIS3-1B11) [Janelia Fluor 646]
NBP3-14052JF646 0.1 mL

Mouse Monoclonal GLIS3 Antibody (PCRP-GLIS3-1B11) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse G protein-coupled receptor kinase 4, Grk4 ELISA KIT
ELI-19396m 96 Tests

Mouse G protein-coupled receptor kinase 4, Grk4 ELISA KIT

Sign In for Pricing
View Details
beta -actin Rabbit Polyclonal Antibody(A283)
JOT-AP15743-01 50ul

beta -actin Rabbit Polyclonal Antibody(A283)

Sign In for Pricing
View Details
beta -actin Rabbit Polyclonal Antibody(A283)
JOT-AP15743-02 100ul

beta -actin Rabbit Polyclonal Antibody(A283)

Sign In for Pricing
View Details
MVP (NM_005115) Human Untagged Clone
SC116936 10 µg

MVP (NM_005115) Human Untagged Clone

Sign In for Pricing
View Details