Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Crocodylus niloticus Histone H2B

Product Specifications

Product Name Alternative

; Histone H2B; Fragment

Abbreviation

Recombinant Crocodylus niloticus Histone H2B protein

UniProt

P02280

Expression Region

2-93aa

Organism

Crocodylus niloticus (Nile crocodile) (African crocodile)

Target Sequence

PEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Molecular Weight

12.3 kDa

References & Citations

"Histone H2B variants from the erythrocytes of an amphibian, a reptile and a bird."van Helden P., Strickland W.N., Brandt W.F., von Holt C. Biochim. Biophys. Acta 533:278-281 (1978)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL28 Recombinant Rabbit Monoclonal Antibody [JE55-90]
ET7111-30 100 µL

MRPL28 Recombinant Rabbit Monoclonal Antibody [JE55-90]

Sign In for Pricing
View Details
ARK5 (NUAK1) Rabbit Polyclonal Antibody
TA379380 100 µL

ARK5 (NUAK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTBP1 Recombinant Mouse monoclonal Antibody
HA610075 100 µg

PTBP1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Fenuron-d5 (phenyl-d5)
TRC-F279491-1MG 1 mg

Fenuron-d5 (phenyl-d5)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111M1-01 20 Tests

Elab Fluor® 700 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human HLA-DR Antibody[L243]
E-AB-F1111M1-02 100 Tests

Elab Fluor® 700 Anti-Human HLA-DR Antibody[L243]

Sign In for Pricing
View Details