Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus niger 3-phytase A (phyA)

Product Specifications

Product Name Alternative

3 phytase A Myo-inositol hexakisphosphate phosphohydrolase A Myo-inositol-hexaphosphate 3-phosphohydrolase A

Abbreviation

Recombinant Aspergillus niger phyA protein

Gene Name

PhyA

UniProt

P34752

Expression Region

24-467aa

Organism

Aspergillus niger

Target Sequence

ASRNQSSCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the hydrolysis of inorganic orthophosphate from phytate.

Molecular Weight

50.8 kDa

References & Citations

"Crystal structure of phytase from Aspergillus ficuum at 2.5-A resolution."Kostrewa D., Gruninger-Leitch F., D'Arcy A., Broger C., Mitchell D., van Loon A.P.G.M.Nat. Struct. Biol. 4:185-190 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EIF4G3 antibody
PAab02725 100 µg

Anti-EIF4G3 antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Caveolin-1 Antibody (S01-9C9)
NBP3-20077-50ul 50 µL

Rabbit Monoclonal Caveolin-1 Antibody (S01-9C9)

Sign In for Pricing
View Details
Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit
MBS285867-01 48 Tests

Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit

Sign In for Pricing
View Details
Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit
MBS285867-02 96 Tests

Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit

Sign In for Pricing
View Details
Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit
MBS285867-03 5x 96 Tests

Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit

Sign In for Pricing
View Details
Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit
MBS285867-04 10x 96 Tests

Human Antibody to group A streptococcal polysaccharide (ASP) ELISA Kit

Sign In for Pricing
View Details