Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium butyricum Botulinum neurotoxin type E, partial

Product Specifications

Product Name Alternative

Botulinum neurotoxin type E; BoNT/E; Bontoxilysin-E) [Cleaved into: Botulinum neurotoxin E light chain; LC; EC 3.4.24.69) ; Botulinum neurotoxin E heavy chain; HC) ]

Abbreviation

Recombinant Clostridium butyricum Botulinum neurotoxin type E protein, partial

UniProt

P30995

Expression Region

2-422aa

Organism

Clostridium butyricum

Target Sequence

PTINSFNYNDPVNNRTILYIKPGGCQQFYKSFNIMKNIWIIPERNVIGTIPQDFLPPTSLKNGDSSYYDPNYLQSDQEKDKFLKIVTKIFNRINDNLSGRILLEELSKANPYLGNDNTPDGDFIINDASAVPIQFSNGSQSILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHGFGSIAIVTFSPEYSFRFKDNSMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLATKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase.

Molecular Weight

49.7 kDa

References & Citations

Neurotoxin type E from Clostridium botulinum and C. butyricum; partial sequence and comparison.Gimenez J., Foley J., Dasgupta B.R.FASEB J. 2:A1750-A1750 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]
TA808903AM 100 µL

Myozenin 1 (MYOZ1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C5]

Sign In for Pricing
View Details
Rat IgG (Fcγ Fragment specific), AlpHcAbs® Goat
HA710320 100 µg

Rat IgG (Fcγ Fragment specific), AlpHcAbs® Goat

Sign In for Pricing
View Details
liver FABP (FABP1) (N-term) Rabbit Polyclonal Antibody
AP23314PU-N 100 µg

liver FABP (FABP1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant HEAB Antibody
RC-16511-01 50 μL

Recombinant HEAB Antibody

Sign In for Pricing
View Details
Recombinant HEAB Antibody
RC-16511-02 100 µL

Recombinant HEAB Antibody

Sign In for Pricing
View Details
Recombinant HEAB Antibody
RC-16511-03 1 mL

Recombinant HEAB Antibody

Sign In for Pricing
View Details