Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD)

Product Specifications

Product Name Alternative

Type I DHQase

Abbreviation

Recombinant Salmonella typhi aroD protein

Gene Name

AroD

UniProt

P24670

Expression Region

1-252aa

Organism

Salmonella typhi

Target Sequence

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Molecular Weight

29.6 kDa

References & Citations

Molecular cloning and characterization of the aroD gene encoding 3-dehydroquinase from Salmonella typhi.Servos S., Chatfield S., Hone D., Levine M., Dimitriadis G., Pickard D., Dougan G., Fairweather N., Charles I.G.J. Gen. Microbiol. 137:147-152 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSTVd TaqMan Probe/Primer and Control Set
TM38610 100 Reactions

PSTVd TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
Filaggrin (FLG) Human Gene Knockout Kit (CRISPR)
KN219792LP 1 Kit

Filaggrin (FLG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Electric lift patient transfer Wheelchair BHBD-1103
BHBD-1103 1 Unit

Electric lift patient transfer Wheelchair BHBD-1103

Sign In for Pricing
View Details
GAS 6 (GAS6) (NM_000820) Human Over-expression Lysate
LY424508 100 µg

GAS 6 (GAS6) (NM_000820) Human Over-expression Lysate

Sign In for Pricing
View Details
Pro-AMC
13457-AAT 5 mg

Pro-AMC

Sign In for Pricing
View Details
Glucosidase 2 subunit beta (PRKCSH) Rabbit Polyclonal Antibody
AP01229PU-N 100 µg

Glucosidase 2 subunit beta (PRKCSH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details