Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus A Outer capsid protein VP4, partial

Product Specifications

Product Name Alternative

; Outer capsid protein VP4; Hemagglutinin) [Cleaved into: Outer capsid protein VP8*; Outer capsid protein VP5*]

Abbreviation

Recombinant Rotavirus A Outer capsid protein VP4 protein, partial

UniProt

P11200

Expression Region

247-479aa

Organism

Rotavirus A (strain Human/United Kingdom/ST3/1975 G4-P2A[6]-I1-R1-C1-M1-A1-N1-T1-E1-H1) (RV-A) (Rotavirus A (strain St. Thomas 3) )

Target Sequence

AQVSEDIIISKTSLWKEMQYNRDIIIRFKFNNSIIKLGGLGYKWSEISFKAANYQYNYLRDGEQVTAHTTCSVNGVNNFSYNGGLLPTHFSISRYEVIKENSYVYVDYWDDSQAFRNMVYVRSLAANLNSVKCSGGNYNFQMPVGAWPVMSGGAVSLHFAGVTLSTQFTDFVSLNSLRFRFSLTVEEPPFSILRTRVSGLYGLPASNPNSGHEYYEIAGRFSLISLVPSNDDY

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 ses to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1 .Outer capsid protein VP5*: forms the spike "foot" and "body". Acts as a mbrane permeabilization protein that mediates release of viral particles from endosomal compartments into the cytoplasm. In integrin-dependent strains, VP5* targets the integrin heterodimer ITGA2/ITGB1 for cell attachment .VP8* forms the head of the spikes. It is the viral hagglutinin and an important target of neutralizing antibodies. In sialic acid-dependent strains, VP8* binds to host cell sialic acid, most probably a ganglioside, providing the initial contact .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virulence. Rotavirus entry into the host cell probably involves multiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 seems to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1 (By similarity) .

Molecular Weight

28.3 kDa

References & Citations

Sequence of the fourth gene of human rotaviruses recovered from asymptomatic or symptomatic infections.Gorziglia M., Green K.Y., Nishikawa K., Taniguchi K., Jones R.W., Kapikian A.Z., Chanock R.M.J. Virol. 62:2978-2984 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTH-rP Double Nickase Plasmid (h)
sc-401209-NIC 20 µg

PTH-rP Double Nickase Plasmid (h)

Sign In for Pricing
View Details
STK17A ORF Vector (Human) (pORF)
ORF033493 1.0 µg DNA

STK17A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FCGR1A   monoclonal antibody
MB10912 50ul

FCGR1A monoclonal antibody

Sign In for Pricing
View Details
AP1B1 polyclonal antibody
BS76725-01 50 µL

AP1B1 polyclonal antibody

Sign In for Pricing
View Details
AP1B1 polyclonal antibody
BS76725-02 100 µL

AP1B1 polyclonal antibody

Sign In for Pricing
View Details
Cefoperazone Dihydrate
TRC-C242905-25MG 25 mg

Cefoperazone Dihydrate

Sign In for Pricing
View Details