Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Toxoplasma gondii Dense granule protein 1 (GRA1)

Product Specifications

Product Name Alternative

Major antigen p24

Abbreviation

Recombinant Toxoplasma gondii GRA1 protein

Gene Name

GRA1

UniProt

P13403

Expression Region

25-190aa

Organism

Toxoplasma gondii

Target Sequence

AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

References & Citations

Molecular characterization of a 23-kilodalton major antigen secreted by Toxoplasma gondii.Cesbron-Delauw M.-F., Guy B., Torpier G., Pierce R.J., Lenzen G., Cesbron J.Y., Charif H., Lepage P., Darcy F., Lecocq J.-P., Capron A.Proc. Natl. Acad. Sci. U.S.A. 86:7537-7541 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdh8 (NM_001042726) Mouse Tagged Lenti ORF Clone
MR225812L4 10 µg

Pcdh8 (NM_001042726) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NDUFS8 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 8, Mitochondrial, Complex I-23kD, NADH-ubiquinone Oxidoreductase 23kD Subunit, TYKY Subunit) (PE)
130245-PE 100 µL

NDUFS8 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 8, Mitochondrial, Complex I-23kD, NADH-ubiquinone Oxidoreductase 23kD Subunit, TYKY Subunit) (PE)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial
MBS1343818-01 0.5 mg (E-Coli)

Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial

Sign In for Pricing
View Details
Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial
MBS1343818-02 0.05 mg (Baculovirus)

Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial

Sign In for Pricing
View Details
Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial
MBS1343818-03 0.5 mg (Yeast)

Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial

Sign In for Pricing
View Details
Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial
MBS1343818-04 0.05 mg (Mammalian-Cell)

Recombinant Macaca fascicularis ADP-ribosyl cyclase 1 (CD38), partial

Sign In for Pricing
View Details