Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dactylis glomerata Pollen allergen Dac g 3, partial

Product Specifications

Product Name Alternative

Allergen Dac g III Allergen: Dac g 3

Abbreviation

Recombinant Dactylis glomerata Pollen allergen Dac g 3 protein, partial

UniProt

P93124

Expression Region

1-96aa

Organism

Dactylis glomerata (Orchard grass) (Cock's-foot grass)

Target Sequence

VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.9 kDa

References & Citations

"Cloning, sequencing and immunological characterization of Dac g 3, a major allergen from Dactylis glomerata pollen."Guerin-Marchand C., Senechal H., Bouin A.P., Leduc-Brodard V., Taudou G., Weyer A., Peltre G., David B.Mol. Immunol. 33:797-806 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MECR Polyclonal Antibody
ANT-13176-50ug 50 µg

MECR Polyclonal Antibody

Ask
View Details
PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13) (PE)
MBS6389074-01 0.1 mL

PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13) (PE)

Ask
View Details
PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13) (PE)
MBS6389074-02 5x 0.1 mL

PER3 (Period Circadian Protein Homolog 3, hPER3, Cell Growth-inhibiting Gene 13 Protein, Circadian Clock Protein PERIOD 3, GIG13) (PE)

Ask
View Details
IKB alpha (NFKBIA) Rabbit Polyclonal Antibody
TA384862 100 µL

IKB alpha (NFKBIA) Rabbit Polyclonal Antibody

Ask
View Details
ZFP62 Human shRNA Plasmid Kit (Locus ID 643836)
TL321511 1 Kit

ZFP62 Human shRNA Plasmid Kit (Locus ID 643836)

Ask
View Details
PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1) (FITC)
MBS6389771-01 0.1 mL

PLEKHO2 (PP9099, PLEKHQ1, Pleckstrin Homology Domain-containing Family O Member 2, PH Domain-containing Family O Member 2, Pleckstrin Homology Domain-containing Family Q Member 1, PH Domain-containing Family Q Member 1) (FITC)

Ask
View Details