Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Scytonema varium Scytovirin

Product Specifications

Product Name Alternative

Scytovirin; SVN

Abbreviation

Recombinant Scytonema varium Scytovirin protein

UniProt

P86041

Expression Region

1-95aa

Organism

Scytonema varium

Target Sequence

GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected C-SS cells with uninfected C-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.

Molecular Weight

11.7 kDa

References & Citations

A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.Bokesch H.R., O'Keefe B.R., McKee T.C., Pannell L.K., Patterson G.M.L., Gardella R.S., Sowder R.C. II, Turpin J., Watson K., Buckheit R.W. Jr., Boyd M.R.Biochemistry 42:2578-2584 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tebuconazole [CAS:107534-96-3] 10 ug/ml in Acetonitrile
P852100 10 mL

Tebuconazole [CAS:107534-96-3] 10 ug/ml in Acetonitrile

Ask
View Details
Lentiviral human VDAC1 shRNA (UAS) - Lentiviral human VDAC1 shRNA (UAS, iRFP) (100)
GTR15319614 1 Vial

Lentiviral human VDAC1 shRNA (UAS) - Lentiviral human VDAC1 shRNA (UAS, iRFP) (100)

Ask
View Details
Rac Galaxolidone-d5 (Mixture of Diastereomers)
464199-01 1 mg

Rac Galaxolidone-d5 (Mixture of Diastereomers)

Ask
View Details
Rac Galaxolidone-d5 (Mixture of Diastereomers)
464199-02 5 mg

Rac Galaxolidone-d5 (Mixture of Diastereomers)

Ask
View Details
Mouse Prkca Antibody
abx027933-01 80 µL

Mouse Prkca Antibody

Ask
View Details
Mouse Prkca Antibody
abx027933-02 400 µL

Mouse Prkca Antibody

Ask
View Details