Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

Product Specifications

Product Name Alternative

Ribosome-inactivating protein lychnin; EC 3.2.2.22

Abbreviation

Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin protein

UniProt

P85101

Expression Region

1-234aa

Organism

Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)

Target Sequence

RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC50 of 0.17 nM.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC (50) of 0.17 nM.

Molecular Weight

28.1 kDa

References & Citations

"Sequence determination of lychnin, a type 1 ribosome-inactivating protein from Lychnis chalcedonica seeds."Chambery A., de Donato A., Bolognesi A., Polito L., Stirpe F., Parente A.Biol. Chem. 387:1261-1266 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK6 Rabbit mAb
MBS4762073-01 0.1 mL

CDK6 Rabbit mAb

Sign In for Pricing
View Details
CDK6 Rabbit mAb
MBS4762073-02 5x 0.1 mL

CDK6 Rabbit mAb

Sign In for Pricing
View Details
INT3 rabbit pAb
MBS8600655-01 0.1 mL

INT3 rabbit pAb

Sign In for Pricing
View Details
INT3 rabbit pAb
MBS8600655-02 0.1 mL (AF405L)

INT3 rabbit pAb

Sign In for Pricing
View Details
INT3 rabbit pAb
MBS8600655-03 0.1 mL (AF405S)

INT3 rabbit pAb

Sign In for Pricing
View Details
INT3 rabbit pAb
MBS8600655-04 0.1 mL (AF610)

INT3 rabbit pAb

Sign In for Pricing
View Details