Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83)

Product Specifications

Product Name Alternative

Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83

Abbreviation

Recombinant Mouse-ear cress LCR83 protein

Gene Name

LCR83

UniProt

P82792

Expression Region

28-82aa

Organism

Arabidopsis thaliana (Mouse-ear cress)

Target Sequence

NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.9 kDa

References & Citations

"Genome organization of more than 300 defensin-like genes in Arabidopsis."Silverstein K.A.T., Graham M.A., Paape T.D., VandenBosch K.A. Plant Physiol. 138:600-610 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), CF740 conjugate, 0.1mg/mL
BNC742092-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/2092R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL
BNC470800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL
BNC042905-500 1x 500 µL

CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (2F3.2), CF594 conjugate, 0.1mg/mL
BNC940811-100 1x 100 µL

ZAP70 (2F3.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), 0.2mg/mL
BNUB0158-100 1x 100 µL

Cytokeratin 17 (E3), 0.2mg/mL

Sign In for Pricing
View Details