Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1)

Product Specifications

Product Name Alternative

Allergen: Alt a 1

Abbreviation

Recombinant Alternaria alternata ALTA1 protein

Gene Name

ALTA1

UniProt

P79085

Expression Region

19-157aa

Organism

Alternaria alternata (Alternaria rot fungus) (Torula alternata)

Target Sequence

APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.2 kDa

References & Citations

Isolation and expression of a cDNA clone encoding an Alternaria alternata Alt a 1 subunit.De Vouge M.W., Thaker A.J., Curran I.H., Zhang L., Muradia G., Rode H., Vijay H.M.Int. Arch. Allergy Immunol. 111:385-395 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBJ (DNAJC27) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]
TA811079AM 100 µL

RBJ (DNAJC27) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin (Ub)
MBS2118112-01 0.1 mL

PE-Linked Polyclonal Antibody to Ubiquitin (Ub)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin (Ub)
MBS2118112-02 0.2 mL

PE-Linked Polyclonal Antibody to Ubiquitin (Ub)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin (Ub)
MBS2118112-03 0.5 mL

PE-Linked Polyclonal Antibody to Ubiquitin (Ub)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin (Ub)
MBS2118112-04 1 mL

PE-Linked Polyclonal Antibody to Ubiquitin (Ub)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Ubiquitin (Ub)
MBS2118112-05 5 mL

PE-Linked Polyclonal Antibody to Ubiquitin (Ub)

Sign In for Pricing
View Details