Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription intermediary factor 1-alpha (TRIM24), partial

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase TRIM24RING finger protein 82Tripartite motif-containing protein 24

Abbreviation

Recombinant Human TRIM24 protein, partial

Gene Name

TRIM24

UniProt

O15164

Expression Region

891-1012aa

Organism

Homo sapiens (Human)

Target Sequence

KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac) . Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac) . Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes (By similarity) .

Molecular Weight

16.5 kDa

References & Citations

Differential interaction of nuclear receptors with the putative human transcriptional coactivator hTIF1.Thenot S., Henriquet C., Rochefort H., Cavailles V.J. Biol. Chem. 272:12062-12068 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 405)
MBS6189867-01 0.1 mL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 405)

Ask
View Details
DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 405)
MBS6189867-02 5x 0.1 mL

DRF1 (ASKL1, Protein DBF4 Homolog B, Activator of S Phase Kinase-like Protein 1, Chiffon Homolog B, Dbf4-related Factor 1, FLJ13087, MGC15009) (MaxLight 405)

Ask
View Details
Recombinant Mouse SOAT2 Protein, N-His
MF606012-01 50 µg

Recombinant Mouse SOAT2 Protein, N-His

Ask
View Details
Recombinant Mouse SOAT2 Protein, N-His
MF606012-02 100 µg

Recombinant Mouse SOAT2 Protein, N-His

Ask
View Details
Recombinant Mouse SOAT2 Protein, N-His
MF606012-03 1 mg

Recombinant Mouse SOAT2 Protein, N-His

Ask
View Details
GRM2, Human (Sf9, His)
HY-P703140 Inquire

GRM2, Human (Sf9, His)

Ask
View Details