Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thyroid peroxidase (TPO), partial

Product Specifications

Product Name Alternative

MSA ; PERT_HUMAN; TDH2A; Thyroid microsomal antigen; Thyroid peroxidase; Thyroperoxidase; TPO; TPX

Abbreviation

Recombinant Human TPO protein, partial

Gene Name

TPO

UniProt

P07202

Expression Region

19-161aa

Organism

Homo sapiens (Human)

Target Sequence

FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T3 and T4.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T (3) and T (4) .

Molecular Weight

17.9 kDa

References & Citations

Isolation of a complementary DNA clone for thyroid microsomal antigen. Homology with the gene for thyroid peroxidase.Seto P., Hirayu H., Magnusson R.P., Gestautas J., Portmann L., Degroot L.J., Rapoport B.J. Clin. Invest. 80:1205-1208 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)
MBS7072698-01 0.05 mg (E-Coli)

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)
MBS7072698-02 0.2 mg (E-Coli)

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)
MBS7072698-03 0.05 mg (Baculovirus)

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)
MBS7072698-04 0.5 mg (E-Coli)

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)
MBS7072698-05 0.2 mg (Yeast)

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)
MBS7072698-06 0.05 mg (Mammalian-Cell)

Recombinant Caenorhabditis elegans Tetraspanin-17 (tsp-17)

Sign In for Pricing
View Details