Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI)

Product Specifications

Product Name Alternative

Extrinsic pathway inhibitor ; EPILipoprotein-associated coagulation inhibitor ; LACI

Abbreviation

Recombinant Rabbit TFPI protein

Gene Name

TFPI

UniProt

P19761

Expression Region

25-300aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Inhibits factor X (X (a) ) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibits factor X (X (a) ) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Molecular Weight

33.8 kDa

References & Citations

CDNA sequence of rabbit lipoprotein-associated coagulation inhibitor.Wesselschmidt R.L., Girard T.J., Broze G.J. Jr.Nucleic Acids Res. 18:6440-6440 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cttn 3'UTR Luciferase Stable Cell Line
TU202953 1.0 mL

Cttn 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human SLC31A1 sgRNA gene knockout kit - Lentiviral human SLC31A1 sgRNA gene knockout kit (100)
GTR15389485 1 Vial

Lentiviral human SLC31A1 sgRNA gene knockout kit - Lentiviral human SLC31A1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
FAM171A2 Protein Vector (Mouse) (pPB-N-His)
PV177523 500 ng

FAM171A2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
FAM113A
CSB-CL867128HU2 10 μg Plasmid + 200 μL Glycerol

FAM113A

Sign In for Pricing
View Details
Calcium metaborate dihydrate
C01530-01 50 g

Calcium metaborate dihydrate

Sign In for Pricing
View Details
Calcium metaborate dihydrate
C01530-02 250 g

Calcium metaborate dihydrate

Sign In for Pricing
View Details