Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Transcobalamin-1 (TCN1)

Product Specifications

Product Name Alternative

CobalophilinHaptocorrin; Protein RTranscobalamin I ; TC I ; TCI

Abbreviation

Recombinant Pig TCN1 protein

Gene Name

TCN1

UniProt

P17630

Expression Region

25-416aa

Organism

Sus scrofa (Pig)

Target Sequence

CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity) . Binds to cobalamin and to cobalamin analogs such as cobinamide.

Molecular Weight

46.3 kDa

References & Citations

Isolation and characterization of a cDNA encoding porcine gastric haptocorrin.Hewitt J.E., Seetharam B., Leykam J.F., Alpers D.H.Eur. J. Biochem. 189:125-130 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMCN2 Rabbit Polyclonal Antibody (Cy3)
orb978941 100 µL

HMCN2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Voltage-dependent calcium channel gamma-5 subunit isoform b antibody
orb73746 100 µL

Voltage-dependent calcium channel gamma-5 subunit isoform b antibody

Sign In for Pricing
View Details
Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)
MBS1097052-01 0.02 mg (E-Coli)

Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)

Sign In for Pricing
View Details
Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)
MBS1097052-02 0.02 mg (Yeast)

Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)

Sign In for Pricing
View Details
Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)
MBS1097052-03 0.1 mg (E-Coli)

Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)

Sign In for Pricing
View Details
Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)
MBS1097052-04 0.1 mg (Yeast)

Recombinant Aspergillus flavus Probable alpha-N-arabinofuranosidase B (abfB)

Sign In for Pricing
View Details