Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

SNCA; Alpha-synuclein

Abbreviation

Recombinant Cynomolgus monkey SNCA protein

Gene Name

SNCA

UniProt

P61142

Expression Region

1-140aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

May be involved in the regulation of dopamine release and transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of dopamine release and transport.

Molecular Weight

16.5 kDa

References & Citations

"Alpha-synuclein A53T substitution associated with Parkinson disease also marks the divergence of Old World and New World primates." Hamilton B.A.Genomics 83:739-742 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FZD6 Protein Vector (Human) (pPM-C-HA)
PV079787 500 ng

FZD6 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)
MBS1306754-01 0.02 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)
MBS1306754-02 0.1 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)
MBS1306754-03 0.02 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)
MBS1306754-04 0.1 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)
MBS1306754-05 0.02 mg (Baculovirus)

Recombinant Acanthamoeba polyphaga mimivirus Probable glutaredoxin (MIMI_R195)

Sign In for Pricing
View Details