Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ; NACP

Abbreviation

Recombinant Human SNCA protein

Gene Name

SNCA

UniProt

P37840

Expression Region

1-140aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Molecular Weight

16.5 kDa

References & Citations

Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease.Ueda K., Fukushima H., Masliah E., Xia Y., Iwai A., Yoshimoto M., Otero D.A., Kondo J., Ihara Y., Saitoh T.Proc. Natl. Acad. Sci. U.S.A. 90:11282-11286 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sirtuin 1 (SIRT1) ELISA Kit
MBS9143991-01 96 Tests

Human Sirtuin 1 (SIRT1) ELISA Kit

Sign In for Pricing
View Details
Human Sirtuin 1 (SIRT1) ELISA Kit
MBS9143991-02 5x 96 Tests

Human Sirtuin 1 (SIRT1) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Immunoglobulin M (IgM) ELISA Kit
OM626320 96 Tests

Guinea Pig Immunoglobulin M (IgM) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human LRRC8E shRNA (UAS) - Lentiviral human LRRC8E shRNA (UAS, iRFP) (100)
GTR15343686 1 Vial

Lentiviral human LRRC8E shRNA (UAS) - Lentiviral human LRRC8E shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
MORN3 Overexpression Lysate (Native) - (Dry Ice)
NBL1-13186 0.1 mg

MORN3 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human coronavirus (HCoV-229E) Nucleoprotein/NP Protein (His Tag)
MBS2569545-01 0.1 mg

Recombinant Human coronavirus (HCoV-229E) Nucleoprotein/NP Protein (His Tag)

Sign In for Pricing
View Details