Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Alpha-1-antiproteinase (Serpina1)

Product Specifications

Product Name Alternative

Alpha-1 protease inhibitorAlpha-1-antiproteinase; Serpin A1

Abbreviation

Recombinant Rat Serpina1 protein

Gene Name

Serpina1

UniProt

P17475

Expression Region

25-411aa

Organism

Rattus norvegicus (Rat)

Target Sequence

EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin.Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitor of serine proteases. The primary target is elastase, but also has a moderate affinity for plasmin and thrombin.

Molecular Weight

45.7 kDa

References & Citations

Cloning and expression in Escherichia coli of full-length complementary DNA coding for human alpha 1-antitrypsin.Bollen A., Herzog A., Cravador A., Herion P., Chuchana P., van der Straten A., Loriau R., Jacobs P., van Elsen A.DNA 2:255-264 (1983)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal TM7SF2 Antibody
NBP1-89089-25ul 25 µL

Rabbit Polyclonal TM7SF2 Antibody

Ask
View Details
Tissue FFPE Sections, Adrenal gland
CS800773 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Ask
View Details
APH1A (NM_001243772) Human Untagged Clone
SC330178 10 µg

APH1A (NM_001243772) Human Untagged Clone

Ask
View Details
GRIN1, glutamate receptor, ionotropic, N-methyl D-aspartate 1, NMDA1, NMDAR1, NR1, N-methyl-D-aspartate receptor channel, subunit zeta-1, NMDA receptor 1, glutamate [NMDA] receptor subunit zeta 1NMDA 1 Receptor, C1 Splice Variant (NMDA R1, N-methyl-D-aspartate) (Biotin) discontinued
N2904-Biotin 100 µL

GRIN1, glutamate receptor, ionotropic, N-methyl D-aspartate 1, NMDA1, NMDAR1, NR1, N-methyl-D-aspartate receptor channel, subunit zeta-1, NMDA receptor 1, glutamate [NMDA] receptor subunit zeta 1NMDA 1 Receptor, C1 Splice Variant (NMDA R1, N-methyl-D-aspartate) (Biotin) discontinued

Ask
View Details
Mouse Villin 1 siRNA
abx939413-01 15 nmol

Mouse Villin 1 siRNA

Ask
View Details
Mouse Villin 1 siRNA
abx939413-02 30 nmol

Mouse Villin 1 siRNA

Ask
View Details