Recombinant Pig E-selectin (SELE), partial
Product Specifications
Product Name Alternative
CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ; ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ; LECAM2; ; CD62E
Abbreviation
Recombinant Pig SELE protein, partial
Gene Name
SELE
UniProt
P98110
Expression Region
23-429aa
Organism
Sus scrofa (Pig)
Target Sequence
WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP
Tag
N-terminal 6xHis-tagged
Type
Developed Protein
Source
Yeast
Field of Research
Others
Relevance
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Cell-surface glycoprotein having a role in immunoadhesion
Molecular Weight
46.3 kDa
References & Citations
Molecular and functional analysis of porcine E-selectin reveals a potential role in xenograft rejection.Rollins S.A., Evans M.J., Johnson K.K., Elliot E.A., Squinto S.P., Matis L.A., Rother R.P.Biochem. Biophys. Res. Commun. 204:763-771 (1994)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Extracellular Domain
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15179389 1 Vial
Lentiviral mouse Cdkl2 shRNA (UAS) - Lentiviral mouse Cdkl2 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
MBS6255689-01 0.1 mL
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (MaxLight 650)
Sign In for Pricing
View Details MBS6255689-02 5x 0.1 mL
CD45 (Leukocyte Common Antigen, LCA, Ly-5 T200) (MaxLight 650)
Sign In for Pricing
View Details 
Z0741-13-ML650 100 µL
ZNF213 (Zinc Finger Protein 213, CR53, Putative Transcription Factor CR53, Zinc Finger Protein with KRAB and SCAN Domains 21, ZKSCAN21, ZSCAN53) (Azide Free) (MaxLight 650)
Sign In for Pricing
View Details GTR15360807 1 Vial
Lentiviral human KLHL36 sgRNA gene knockout kit - Lentiviral human KLHL36 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details