Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING-box protein 2 (RNF7)

Product Specifications

Product Name Alternative

CKII beta-binding protein 1 ; CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein

Abbreviation

Recombinant Human RNF7 protein

Gene Name

RNF7

UniProt

Q9UBF6

Expression Region

2-113aa

Organism

Homo sapiens (Human)

Target Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription

Molecular Weight

14.6 kDa

References & Citations

Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif.Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S.Biochem. Biophys. Res. Commun. 263:743-748 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM3AP Protein Lysate (Rat) with C-HA Tag
28228036 100 µg

MCM3AP Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
5-Pyrimidinecarboxylic acid, 6-amino-1,2-dihydro-2-oxo-, ethyl ester
OR1042525-01 100 mg

5-Pyrimidinecarboxylic acid, 6-amino-1,2-dihydro-2-oxo-, ethyl ester

Sign In for Pricing
View Details
5-Pyrimidinecarboxylic acid, 6-amino-1,2-dihydro-2-oxo-, ethyl ester
OR1042525-02 250 mg

5-Pyrimidinecarboxylic acid, 6-amino-1,2-dihydro-2-oxo-, ethyl ester

Sign In for Pricing
View Details
5-Pyrimidinecarboxylic acid, 6-amino-1,2-dihydro-2-oxo-, ethyl ester
OR1042525-03 1 g

5-Pyrimidinecarboxylic acid, 6-amino-1,2-dihydro-2-oxo-, ethyl ester

Sign In for Pricing
View Details
GTPBP9 Lentiviral Activation Particles (m)
sc-426354-LAC 200 µL

GTPBP9 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human DOC2B Recombinant Protein
PPT-12323 100 µg

Human DOC2B Recombinant Protein

Sign In for Pricing
View Details