Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat RegeneRating islet-derived protein 3-gamma (Reg3g)

Product Specifications

Product Name Alternative

Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ; Reg III-gamma

Abbreviation

Recombinant Rat Reg3g protein

Gene Name

Reg3g

UniProt

P42854

Expression Region

27-174aa

Organism

Rattus norvegicus (Rat)

Target Sequence

EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury (By similarity) .

Molecular Weight

18.3 kDa

References & Citations

Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Arthroderma benhamiae Probable zinc metalloprotease ARB_05554 (ARB_05554), partial
MBS1250019-01 1 mg (E-Coli)

Recombinant Arthroderma benhamiae Probable zinc metalloprotease ARB_05554 (ARB_05554), partial

Ask
View Details
Recombinant Arthroderma benhamiae Probable zinc metalloprotease ARB_05554 (ARB_05554), partial
MBS1250019-02 1 mg (Yeast)

Recombinant Arthroderma benhamiae Probable zinc metalloprotease ARB_05554 (ARB_05554), partial

Ask
View Details
Recombinant Uncharacterized protein Mb1855 (Mb1855)
MBS7040979-01 0.02 mg

Recombinant Uncharacterized protein Mb1855 (Mb1855)

Ask
View Details
Recombinant Uncharacterized protein Mb1855 (Mb1855)
MBS7040979-02 0.1 mg

Recombinant Uncharacterized protein Mb1855 (Mb1855)

Ask
View Details
Recombinant Uncharacterized protein Mb1855 (Mb1855)
MBS7040979-03 5x 0.1 mg

Recombinant Uncharacterized protein Mb1855 (Mb1855)

Ask
View Details
MEF2B (Myocyte-specific Enhancer Factor 2B, RSRFR2, Serum Response Factor-like Protein 2, XMEF2, FLJ32599, FLJ46391, MGC189732, MGC189763) (HRP) discontinued
129557-HRP 100 µL

MEF2B (Myocyte-specific Enhancer Factor 2B, RSRFR2, Serum Response Factor-like Protein 2, XMEF2, FLJ32599, FLJ46391, MGC189732, MGC189763) (HRP) discontinued

Ask
View Details