Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g)

Product Specifications

Product Name Alternative

Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ; Reg III-gamma

Abbreviation

Recombinant Mouse Reg3g protein

Gene Name

Reg3g

UniProt

O09049

Expression Region

27-174aa

Organism

Mus musculus (Mouse)

Target Sequence

EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.

Molecular Weight

18.3 kDa

References & Citations

Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.Mukherjee S., Partch C.L., Lehotzky R.E., Whitham C.V., Chu H., Bevins C.L., Gardner K.H., Hooper L.V.J. Biol. Chem. 284:4881-4888 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL37 Rabbit Polyclonal Antibody
TA381064 100 µL

RPL37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS500346 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Sec11c (NM_025468) Mouse Tagged ORF Clone
MG201853 10 µg

Sec11c (NM_025468) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: SPM576]
AM50186PU-T 20 µg

Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: SPM576]

Sign In for Pricing
View Details
ZNF690 / ZSCAN29 (ZSCAN29/2610), Biotin conjugate, 0.1mg/mL
BNCB2610-500 1x 500 µL

ZNF690 / ZSCAN29 (ZSCAN29/2610), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GNAT1 activation kit by CRISPRa
GA101851 1 Kit

Human GNAT1 activation kit by CRISPRa

Sign In for Pricing
View Details